evan s blue counterstain Search Results


304 318 amino acid sequence  (Bio-Rad)
93
Bio-Rad 304 318 amino acid sequence
Primary and secondary antibodies used in the present study
304 318 Amino Acid Sequence, supplied by Bio-Rad, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/evan+s+blue+counterstain/Evans+Blue+Counterstain/pmc06326948-99-49-83
Average 93 stars, based on 1 article reviews
304 318 amino acid sequence - by Bioz Stars, 2026-10
93/100 stars
  Buy from Supplier
evan's blue counterstain  (BioDiagnostics Inc)
90
BioDiagnostics Inc evan's blue counterstain
Primary and secondary antibodies used in the present study
Evan's Blue Counterstain, supplied by BioDiagnostics Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/evan+s+blue+counterstain/evan+s+blue+counterstain/pmc01656544-33-14-23
Average 90 stars, based on 1 article reviews
evan's blue counterstain - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
prionics evans blue counterstain  (Thermo Fisher)
N/A
Counterstain for immunofluorescence staining with FITC labeled antibodies.
   Buy from Supplier

Image Search Results


Primary and secondary antibodies used in the present study

Journal: Journal of Anatomy

Article Title: Morphology of GNAT 3‐immunoreactive chemosensory cells in the rat larynx

doi: 10.1111/joa.12914

Figure Lengend Snippet: Primary and secondary antibodies used in the present study

Article Snippet: Immunohistochemistry Details of the antibodies used in the present study and their combinations are shown in Tables and , respectively. table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 No. Antibody against Antigen Manufacturer; host; catalog number; RRID Dilution Function; Immunohistochemical marker for Primary antibodies GNAT3 Synthetic peptide (KNQFLDLNLKKEDKE), 304–318 amino acid sequence of human GNAT3 Abcam (Cambridge, UK); goat; ab113664; AB_10866449 1,2,000 Taste signaling protein; Chemosensory cells Synaptosomal‐associated protein 25 kD (SNAP25) Crude human synaptic immunoprecipitated (Characterized by Honer et al. 1993) Bio‐Rad (Hercules, CA, USA); mouse (monoclonal); MCA1308; AB_322417 1:2,000 SNARE protein; Neuroendocrine cells and certain nerve fibers Espin Recombinant protein (SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK), 123–182 amino acid sequence of human espin Novus Biologicals (Littleton, CO, USA); rabbit; NBP1‐90588; AB_11015490 1:100 Actin‐binding protein; Certain microvilli P2X3 ATP receptor (P2X3) Synthetic peptide (VEKQSTDGAYSIGH),383–397 amino acid sequence of rat P2X3 Neuromics (Edina, MN, USA); rabbit; RA10109; AB_2157930 1:4,000 Ionotropic ATP receptor; Certain sensory nerves Secondary antibodies a Alexa Fluor 488‐labeled anti‐goat IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 705‐545‐147; AB_2336933 1:200 b Alexa Fluor 488‐labeled anti‐rabbit IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 711‐545‐152; AB_2313584 1:200 c Cy3‐labeled anti‐mouse IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 715‐165‐151; AB_2315777 1:100 d Cy3‐labeled anti‐rabbit IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 711‐165‐152; AB_2307443 1:100 e Cy3‐labeled anti‐goat IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 705‐165‐147; AB_2307351 1:100 f Alexa Fluor 647‐labeled anti‐mouse IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 715‐605‐150; AB_2340862 1:100 Open in a separate window The antibody numbers and symbols in this table are also used in Table .

Techniques: Immunohistochemical staining, Marker, Sequencing, Immunoprecipitation, Recombinant